PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00722.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 244aa    MW: 28001.7 Da    PI: 8.4777
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00722.50genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.59.9e-31115169155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    k+r+rW+ +LH++Fve+v+++GG++kAtPk+il++mk kgLt+ hvkSHLQkYR+
  Jcr4S00722.50 115 KKRIRWSDDLHRKFVECVNSIGGADKATPKAILKMMKSKGLTIFHVKSHLQKYRS 169
                    78****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.165112172IPR017930Myb domain
SuperFamilySSF466891.97E-16113169IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.4E-28113170IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23115170IPR006447Myb domain, plants
PfamPF002493.6E-7119168IPR001005SANT/Myb domain
PfamPF143794.8E-14196241IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MDGGSQLGHQ ILEEAKMSSS IPASHLDHLP SPFFANQSYL DFQQQLEYEI ATSLSPLQVP  60
EPNNAKMPHS CENFENNPEL IFPTEQEKSS SARDLERASL ISSSGSSRPV FSSDKKRIRW  120
SDDLHRKFVE CVNSIGGADK ATPKAILKMM KSKGLTIFHV KSHLQKYRSE KIICEXKTDE  180
RTISDMPQLY MKKTLKIKEA LQLQLDVEKH IHQQLEIQRQ LQLQIEENGR QLKLMLQQQQ  240
KLNK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530353.12e-59PREDICTED: protein PHR1-LIKE 1
SwissprotQ8GUN55e-41PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLB9SWI43e-59B9SWI4_RICCO; Transcription factor, putative
STRINGPOPTR_0453s00230.17e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2696333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.21e-34G2-like family protein